PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG511200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 548aa    MW: 60123.1 Da    PI: 6.444
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG511200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.11.3e-1331775461373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l+elL++cA+av++++  +++ ++ +l++++s +g+p++R+ ay++e+L arla+s++++ykal+++e +   ss+ l++++l++e++P+
  Pavir.2KG511200.1.p 177 LKELLIACARAVEHNNSFAIDLMIPELRKMVSVSGEPFERMGAYMVEGLVARLASSGNSIYKALKCKEPK---SSDLLSYMHLLYEACPY 263
                          5799*****************************************************************9...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +kf+++ aN aI eav+ge+r+HiiDf i qG+QW++LlqaLa+Rp+gpp +RiTg++++ s   +   le +g+rL+++A   +vpf+f
  Pavir.2KG511200.1.p 264 FKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQWISLLQALAARPGGPPFVRITGIDDSVSAyaRGGGLELVGRRLSHIAGLYKVPFQF 353
                          ***********************************************************888899999********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ va + +++e  +L++ pgEa+aVn+ l+lh+++de+vs++++rd++L+lvk+lsPkv+++veqe+++n+++F++rf+e+l+yy+a+f
  Pavir.2KG511200.1.p 354 NA-VAISGSEVEEGHLSIVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGLSPKVLTLVEQESNTNTAPFAQRFAETLDYYTAIF 442
                          **.68899********************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +s++  lpr+++eri++E+++l+reivn+vaceg+er+erhe ++kW++rl++aGF+p pls  +++++k+ll+ ++ d y++ e++g l
  Pavir.2KG511200.1.p 443 ESIDLALPRDDRERINMEQHCLAREIVNLVACEGEERVERHEVFGKWKARLMMAGFRPSPLSALVNATIKTLLQSYSPD-YKLAERDGVL 531
                          *****************************************************************************66.********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          +lgWk+rpLv+ SaW
  Pavir.2KG511200.1.p 532 YLGWKNRPLVVSSAW 546
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.26151528IPR005202Transcription factor GRAS
PfamPF035144.5E-131177546IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MADTPTSRMV HPFGNAPRQT PKQFLYSGNA QHLCHPYQSA SDTHVVPQHH CTMKSHSPDA  60
GSEEHETHKQ YTLDSSAGSG CSRHDSPSSQ SIHTGSGSPL SHEDSHSGST NGNGSPVSAS  120
CVTEDPTDLK QKLKDLEAVM LGTESEIVDS LEISVANQLS LEPEKWVHMM SMPKGNLKEL  180
LIACARAVEH NNSFAIDLMI PELRKMVSVS GEPFERMGAY MVEGLVARLA SSGNSIYKAL  240
KCKEPKSSDL LSYMHLLYEA CPYFKFGYMS ANGAIAEAVK GEDRIHIIDF HIAQGAQWIS  300
LLQALAARPG GPPFVRITGI DDSVSAYARG GGLELVGRRL SHIAGLYKVP FQFNAVAISG  360
SEVEEGHLSI VPGEAVAVNF TLELHHIPDE TVSTANHRDR ILRLVKGLSP KVLTLVEQES  420
NTNTAPFAQR FAETLDYYTA IFESIDLALP RDDRERINME QHCLAREIVN LVACEGEERV  480
ERHEVFGKWK ARLMMAGFRP SPLSALVNAT IKTLLQSYSP DYKLAERDGV LYLGWKNRPL  540
VVSSAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-651815478375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.7690.0callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639280.0BT063928.1 Zea mays full-length cDNA clone ZM_BFc0120M18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958142.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK3ZS380.0K3ZS38_SETIT; Uncharacterized protein
STRINGSi029418m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein